PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr9P22190_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family MYB
Protein Properties Length: 315aa    MW: 35776 Da    PI: 5.4203
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr9P22190_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.55.5e-121462148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT...TTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg...kgRtlkqcksrwqkyl 48
                           +g W++eEde+l++ + ++G g+W++   ++    + R++k+c++rw +yl
  GSMUA_Achr9P22190_001 14 KGLWSPEEDEKLYNHIIRYGVGCWSS--THLLlagLQRCGKSCRLRWINYL 62
                           678***********************..666667***************97 PP

2Myb_DNA-binding46.87.1e-1568112147
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                            rg++++ E++l++ +++ lG++ W+ Ia+ ++ gRt++++k++w++ 
  GSMUA_Achr9P22190_001  68 RGSFSQNEEDLIISLHAILGNR-WSQIASQLP-GRTDNEIKNFWNSC 112
                            899*******************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-22665IPR009057Homeodomain-like
PROSITE profilePS5129414.137962IPR017930Myb domain
SuperFamilySSF466897.52E-2711109IPR009057Homeodomain-like
SMARTSM007176.6E-91364IPR001005SANT/Myb domain
PfamPF002491.4E-101462IPR001005SANT/Myb domain
CDDcd001671.02E-81762No hitNo description
PROSITE profilePS5129424.66963117IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.8E-2666117IPR009057Homeodomain-like
SMARTSM007176.9E-1467115IPR001005SANT/Myb domain
PfamPF002491.1E-1368112IPR001005SANT/Myb domain
CDDcd001677.51E-970110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MGRHSCCLKQ KIRKGLWSPE EDEKLYNHII RYGVGCWSST HLLLAGLQRC GKSCRLRWIN  60
YLRPDLKRGS FSQNEEDLII SLHAILGNRW SQIASQLPGR TDNEIKNFWN SCLKKKLRQR  120
GIDPSSHKPL NEIKAEEDET RMYCSNTGAT SEELPTKPVF DTFPLVEIQT CLDSVAEDNV  180
NIYNQIHQTL EPLGQKEGLC DYSSALYVTE KFGYGESSSN SCNWNCSIGS EMNNVLGIEA  240
LNWASAEKVE APTHVQINGV ESHEQRYSSW QEKQDMESSE DYSTYPLISL SHDLSGTCFN  300
VPRGALASEF NVDFF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-28311716128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1112118LKKKLRQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009418467.10.0PREDICTED: myb-related protein Hv33-like
SwissprotP200278e-84MYB3_HORVU; Myb-related protein Hv33
TrEMBLM0U2H80.0M0U2H8_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr9P22190_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23273391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.15e-78myb domain protein 86